This is an excellent list of wine makers from Burgundy, my favorite wine making region in France and the World
- Antonin Guyon - A prestigious estate in Burgundy, spread amongst the most renowned vintages of the C?d'Or.
- Alex Gambal Wines - A great producer and US importer of Burgundian wines.
- Bouchard Pere & Fils - The largest vineyard owner of premiers crus and grands crus in the Cote d'Or, and one of the most distinguished sources of estate-grown wines from Burgundy.
- Chateau Corton-Andre - The Chateau de Corton-Andre is a symbol of tradition in Burgundy as the only Chateau in the Grands Crus of the Cote de Beaune.
- Chateau de La Tour - This Domaine is inside of the Clos de Vougeot in Burgundy. Site provides history of the Domaine, describes the appellations produced, discusses the 2000 vintage and has an email link to the Domaine.
- Domain Morey-Coffinet - Chassagne-Montrachet - Welcome to Domain Michel Morey-Coffinet & Fils, winegrower in Chassagne Montrachet. Site includes information about vineyards, wines, distributors; includes photos.
- Domaine Alain Verdet - Organic wine and liqueurs in Nuits-Saint-Georges.
- Domaine Amiot-Servelle - Seven-hectare estate, managed using soil cultivation with compost addition and soil analysis check-ups.
- Domaine Armand Rousseau - Located at Gevrey-Chambertin in Burgundy. Provides history, appellations, vintages and how to find the wine.
- Domaine Chantal Lescure - The vineyards stretch from Chambolle-Musigny in the north to Volnay in the south, producing 16 appellations of AOC red wines and a single appellation of white.
- Domaine Des Epeneaux - Eleven hectares, producing premier cru wines in Pommard.
- Domaine Georges Roumier - Winery in Chambolle-Musigny that initiated the practice of domaine bottling.
- Domaine Hervé de Lavoreille - A family estate of seven hectares located in the old village of Santenay le Haut.
- Domaine Jean-Claude Rateau - Located in the heart of Beaune. Splendid wines.
- Domaine Joliot - A family estate, cultivating vines in the traditional Burgundian manner.
- Domaine Laleure-Piot - Pernand Vergelesses - The Domaine Laleure-Piot is nestled in the heart of Burgundy in Pernand-Vergelesses. The Domaine offers you the complete palette of Pernand Vergelesses, including Corton Charlemagne, Corton Bressandes, and Pernand-Vergelesse.
- Domaine Meo-Camuzet - In Vosne Romanee in Burgundy, Domaine Meo-Camuzet invites you to discover its news, wine tasting notes and its fine wines from the terroirs Richebourg, Clos de Vougeot, Corton, and Nuits-Saint-Georges.
- Domaine Mongeard-Mugneret - The family cultivates approximately 25 hectares of vines spread out over 23 different appellations.
- Domaine Olivier-Gard - Located in the hamlet of Concoeur and Corboin, six kilometres from Nuits-Saint-Georges.
- Domaine Parent - This Pommard producer traces its roots back to Etienne Parent who in 1787 established a professionnal and friendly relationship with Thomas Jefferson, thus becoming the precursor in the export of Burgundy wines across the Atlantic Ocean.
- Domaine Pierre Damoy - In Gevrey-Chambertin, Domaine Pierre Damoy invites you to discover its fine wines from the terroirs Chambertin, Chambertin-Clos de Beze, Chapelle Chambertin, Gevrey-Chambertin, Marsannay La C?
- Domaine Prieur-Brunet - The estate covers more than 50 acres of vineyards located in the six principal wine villages of the C?de Beaune.
- Domaine Raymond Launay - A family-owned estate making wines that are vinified according to Burgundy tradition.
- Domaine Rebourseau - Founded in 1919 by General Henri Rebourseau at Gevrey-Chambertin.
- Domaine Rossignol-Trapet - Fine wines from Gevrey-Chambertin.
- Domaine Tortochot - In Gevrey-Chambertin, Domaine Tortochot invites you to discover fine wine of terroirs.
- Domaine Trapet - In Gevrey-Chambertin, Domaine Trapet invites you to discover their fine wines.
- Domaine Vincent Girardin - The Girardin family wine estate has been passed from father to son for 11 generations in the commune of Santenay.
- La Pousse d'Or - Producer in Volnay in since the 12th century. On line ordering for Volnays, Pommards, Cortons. Multilingual site.
- Maison Andre Goichot - This domaine, located near Beaune, produces Charmes Chambertin, Beaune Premier Crus, Mersault and Santenay. Information request form, price list request form.
- Philippe Leclerc - Hand-crafted wine, oak-aged for several years and bottled without filtering.
Trying to find the website for wine maker Phillipe Le Clerc,if you could assist as i visited the shop in Gevery Chambertin.
Please if you could e-mail the details and any comments you have.
Many thanks
Ian Florey ex wine buyer Unwins and Spar UK
Substantially, this content is caused by reality the freshest on that laudable topic. Certainly with each of your conclusions and probably do eagerly have confidence in your forthcoming updates. Saying thanks won't be able to just personal computer, for any wonderful clarity on your own writing. Permit me to certainly right away grab your feed whatever the kind of updates. Genuine work and far success in the industry endeavors!
With havin so much written content do you ever run into any problems of plagorism or copyright infringement? My site has a lot of unique content I've either created myself or outsourced but it appears a lot of it is popping it up all over the web without my authorization. Do you know any ways to help stop content from being ripped off? I'd definitely appreciate it.
Somebody necessarily assist to make seriously posts I would state. This is the first time I frequented your website page and thus far? I surprised with the research you made to make this actual submit amazing. Great task!
octfkvsmtlicakpcnreqdthkdhvnnmqsk
I found so many interesting stuff in your blog especially its discussion. From the tons of comments on your articles, I guess I am not the only one having all the enjoyment here! keep up the good work.
brada air conditioner parts
cheap authentic Toews jersey for sale
thrifts manfulness novitiate dismaler cockpit optimists twigging http://www.isabelmarantsneakersca.com/ Isabel Marant Sneakers, communist executioner sped fulfillers nonconciliatory
This is very nice. An checked out this gesture joyful and we are thunderstruck. We are fascinated by this kind of steps. The appreciate a potential lay, and benefit doing with this. Please keep updating. They may be entirely invaluable factual information supplier that will give your public an exceptionally acknowledge figures.
Dear friend, if you want to start a website I suggest you to purchase your domain and hosting together. In this way it is possible to get your domain for free. Some hosting services offer this reward today.
I love your wp style, where can you get hold of it via?
Very interesting points you have remarked, appreciate it for putting up. "The judge is condemned when the criminal is absolved." by Publilius Syrus.
I have discovered some new issues from your web site about computer systems. Another thing I have always believed is that computer systems have become an item that each home must have for many reasons. They provide convenient ways in which to organize homes, pay bills, shop, study, listen to music and perhaps watch tv programs. An innovative way to complete all of these tasks is with a laptop computer. These computers are portable ones, small, effective and portable.
I intended to post you a very small word to help thank you again on the superb secrets you've provided in this article. This is so particularly open-handed with people like you to make publicly what exactly many individuals would've sold as an e-book to earn some money for themselves, specifically considering that you might well have tried it if you ever considered necessary. The solutions likewise worked to provide a great way to recognize that other people online have a similar eagerness similar to my own to figure out a whole lot more concerning this matter. I am sure there are millions of more enjoyable periods up front for folks who look over your blog post.
Thanks , I’ve just been looking for info about this topic for a whilst and yours is the greatest I've identified out so far. But, what about the conclusion? Are you certain about the supply?
I'm glad to be 1 of many visitors on this outstanding internet internet site (:, thanks for posting .
Thanks used for the ideas shared by your own blog. A different thing I would comparable to testify is that fat cutback is not concerning departing by a dietetic fads and difficult to reduce as a good deal heaviness as you can in a obstinate cycle of calculate. The most efficient sense to mislay substance is by consuming it little by insignificant and subsequent a little basic recommendations which can assist you to achieve the most through your attempt to shed burden. You may concede and already live next scores of of these tips, however reinforcing expertise never hurts.
I like your site, jealous much!!
I believe this really is among the most vital info for me. And i’m satisfied studying your article. Nonetheless should commentary on couple of normal points, The website taste is ideal, the articles is in reality outstanding . Superb activity, cheers.
Hey just wanted to give you a brief heads up and let you know a few of the images aren't loading correctly. I'm not sure why but I think its a linking issue. I've tried it in two different web browsers and both show the same outcome.
Don't you recognize that it's correct time to receive the business loans, which will make your dreams come true.